Skip to Content

Creatine kinase B chain

Antibody: CPTC-CKB-1

Background

Catalog Number:
CPTC-CKB-1
Target Antigen:
Creatine kinase B chain
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CKB-1 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CKB-1 Western blot

Western Blot using CPTC-CKB-1 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CKB-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-CKB-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-CKB-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-CKB-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-CKB-1.pdf (104.3 KB)

CPTC-CKB-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-CKB-2

Background

Catalog Number:
CPTC-CKB-2
Target Antigen:
Creatine kinase B chain
Isotype:
IgG2b
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CKB-2 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CKB-2 Western blot

Western Blot using CPTC-CKB-2 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CKB-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-CKB-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-CKB-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-CKB-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-CKB-2.pdf (104.0 KB)

CPTC-CKB-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-CKB-3

Background

Catalog Number:
CPTC-CKB-3
Target Antigen:
Creatine kinase B chain
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CKB-3 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CKB-3 Western blot

Western Blot using CPTC-CKB-3 as primary Ab against CKB (Ag 10328) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CKB-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-CKB-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-CKB-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-CKB-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-CKB-3.pdf (99.8 KB)

CPTC-CKB-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Creatine kinase B chain

Background

NCI Identification Number:
10328
Antigen Name:
Creatine kinase B chain
CPTC Name:
CPTC-CKB
Keywords:
CKB; B-CK; CKBB; EC 2.7.3.2
Function:
The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The
encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a
heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.
Chromosomal Localization:
14q32
Expression System:
E. Coli
NCBI Accession Number:
BC019281
Swiss Prot Accession Number:
P12277
DNA Source:
HIP:HsCD00004710
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
35535
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGV
DNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNY
VLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLID
DHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRF
CTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRL
QKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Native Sequence:
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNP
GHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLS
SRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHF
LFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTG
LTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKR
GTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Calculated Isoelectric Point:
5.34
Molecular Weight:
42917
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

Ag 10328

PAGE of Ag 10328 with molecular weight standards (lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com