Skip to Content

Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Antibody: CPTC-CHP2-1

Background

Catalog Number:
CPTC-CHP2-1
Target Antigen:
Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)
Isotype:
IgG2a
Species:
Mouse
Last Updated:
04/09/2013
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHP2-1 as primary Ab against CHP2 (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHP2-1 Western blot

Western Blot using CPTC-CHP2-1 as primary Ab against CHP2 (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHP2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-CHP2-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-CHP2-1 NCI 60 Protein Array

Protein Array in which CPTC-CHP2-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer  showing cytoplasmic staining using Antibody CPTC-CHP2-1. Titer: 1:20000
Click to enlarge

CPTC-CHP2-1 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-CHP2-1. Titer: 1:20000

Antibody: CPTC-CHP2-2

Background

Catalog Number:
CPTC-CHP2-2
Target Antigen:
Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)
Isotype:
IgG2a
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHP2-2 as primary Ab against CHP2 (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHP2-2 Western blot

Western Blot using CPTC-CHP2-2 as primary Ab against CHP2 (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHP2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Antibody: CPTC-CHP2-3

Background

Catalog Number:
CPTC-CHP2-3
Target Antigen:
Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)
Isotype:
IgG2b
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHP2-3 as primary Ab against CHP2 (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHP2-3 Western blot

Western Blot using CPTC-CHP2-3 as primary Ab against CHP2 (rAg 10981) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHP2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-CHP2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-CHP2-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-CHP2-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)

Background

NCI Identification Number:
10965
Antigen Name:
Calcineurin B homologous protein 2 (Hepatocellular carcinoma-associated antigen 520)
CPTC Name:
CPTC-CHP2
Keywords:
HCA520
Function:
Binds to and activates SLC9A1/NHE1 in a serum-independent manner, thus increasing pH and protecting cells from serum deprivation-induced death.
Chromosomal Localization:
16p12.1
Expression System:
E. Coli
NCBI Accession Number:
NM_022097.2
Swiss Prot Accession Number:
O43745
DNA Source:
OB : LIFESEQ2330165
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
4470
Buffers:
PBS
Expressed Sequence:
SNAMGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRA
LDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQR
VDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLH
YAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIA
DRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK
Native Sequence:
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDR
NKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDF
PGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRT
VQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK
Calculated Isoelectric Point:
5.89
Molecular Weight:
22.45
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHP2 SDS-PAGE

PAGE of CHP2 (rAg 10965) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com