Skip to Content

Choline Kinase Alpha

Antibody: CPTC-CHKA-1

Background

Catalog Number:
CPTC-CHKA-1
Target Antigen:
Choline Kinase Alpha
Isotype:
IgG1
Species:
Mouse
Last Updated:
12/28/2012
Antigen Recognition(s):

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHKA-1 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHKA-1 Western blot

Western Blot using CPTC-CHKA-1 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHKA-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-CHKA-2

Background

Catalog Number:
CPTC-CHKA-2
Target Antigen:
Choline Kinase Alpha
Isotype:
IgG2a
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHKA-2 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHKA-2 Western blot

Western Blot using CPTC-CHKA-2 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHKA-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antibody: CPTC-CHKA-3

Background

Catalog Number:
CPTC-CHKA-3
Target Antigen:
Choline Kinase Alpha
Isotype:
IgG2a
Species:
Mouse
Last Updated:
11/26/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHKA-3 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHKA-3 Western blot

Western Blot using CPTC-CHKA-3 as primary Ab against CHKA (rAg 00008) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHKA-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

Characterization SOP Files

Antigen: Choline Kinase Alpha

Background

NCI Identification Number:
00008
Antigen Name:
Choline Kinase Alpha
CPTC Name:
CPTC-CHKA
Keywords:
choline kinase alpha1; Ck; EK; CHK; CK1; choline kinase; Ethanolamine kinase; EC 2.7.1.32; CHETK-alpha; EC 2.7.1.82
Function:
The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded
by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes
the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.

Has a key role in phospholipid biosynthesis and may contribute to tumor cell growth. Catalyzes the first step in phosphatidylcholine biosynthesis. Contributes to phosphatidylethanolamine biosynthesis. Phosphorylates choline and
ethanolamine. Has higher activity with choline.
Chromosomal Localization:
11q13.2
Expression System:
E. coli
NCBI Accession Number:
NM_001277
Swiss Prot Accession Number:
P35790
DNA Source:
Mammalian Gene Collection
Immunogen:
Recombinant Domain
Vector Name:
pET28-LIC
Extinction Coefficient:
Buffers:
Expressed Sequence:
MGSSHHHHHHSSGLVPRGSpqppadeqpeprtrrraylwckeflp
gawrglredefhisvirgglsnmlfqcslpdttatlgdeprkvll
rlygailqmrscnkegseqaqkenefqgaeamvlesvmfailaer
slgpklygifpqgrleqfipsrrldteelslpdisaeiaekmatf
hgmkmpfnkepkwlfgtmekylkevlrikfteesrikklhkllsy
nlplelenlrsllestpspvvfchndcqegnilllegrensekqk
lmlidfeyssynyrgfdignhfcewmydysyekypffranirkyp
tkkqqlhfissylpafqndfenlsteeksiikeemllevnrfala
shflwglwsivqakissiefgymdyaqarfdayfhqkrklgv
Native Sequence:
Calculated Isoelectric Point:
0
Molecular Weight:
46923
Last Updated:
12/02/2013

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-CHKA PAGE

PAGE of CHKA (Ag 0008) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com