Skip to Content

Chromogranin A

Antibody: CPTC-CHGA-1

Background

Catalog Number:
CPTC-CHGA-1
Target Antigen:
Chromogranin A
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHGA-1 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHGA-1 Western Blot

Western Blot using CPTC-CHGA-1 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CHGA-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-CHGA-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-CHGA-1 NCI 60 Protein Array

Protein Array in which CPTC-CHGA-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

CPTC-CHGA-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-CHGA-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-CHGA-2

Background

Catalog Number:
CPTC-CHGA-2
Target Antigen:
Chromogranin A
Isotype:
IgG1
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHGA-2 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHGA-2 Western Blot

Western Blot using CPTC-CHGA-2 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CHGA-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-CHGA-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-CHGA-2 NCI 60 Protein Array

Protein Array in which CPTC-CHGA-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

CPTC-CHGA-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-CHGA-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-CHGA-3

Background

Catalog Number:
CPTC-CHGA-3
Target Antigen:
Chromogranin A
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CHGA-3 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CHGA-3 Western Blot

Western Blot using CPTC-CHGA-3 as primary Ab against Ag 10131 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CHGA-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-CHGA-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-CHGA-3 NCI 60 Protein Array

Protein Array in which CPTC-CHGA-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC NCI60

CPTC-CHGA-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-CHGA-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antigen: Chromogranin A

Background

NCI Identification Number:
10131
Antigen Name:
Chromogranin A
CPTC Name:
CPTC-CHGA
Keywords:
parathyroid secretory protein 1; CHGA; CGA; CgA; SP-I
Function:
The protein encoded by this gene is a member of the chromogranin/secretograninfamily of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown. Pancreastatin strongly inhibits glucose induced insulin release from the pancreas.
Chromosomal Localization:
14q32
Expression System:
E. Coli
NCBI Accession Number:
BC006459
Swiss Prot Accession Number:
P10645
DNA Source:
HIP:HsCD00003729
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
28023
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDER
ILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQ
AELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKA
EGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVD
REKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLG
YKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMA
VVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLE
GQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLP
LQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Native Sequence:
MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMP
VSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFED
ELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQA
LPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSE
GLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLN
PHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEE
EEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKR
LEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLP
LQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Calculated Isoelectric Point:
4.57
Molecular Weight:
49077
Last Updated:
04/09/2013

Links

Characterization Data

Gel

Click to enlarge image Protein Array in which CPTC-CHGA-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

Ag 10131

PAGE of Ag 10131 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com