Skip to Content

Cell division cycle 34 homolog (S. Cerevisiae)

Antibody: CPTC-CDC34-1

Background

Catalog Number:
CPTC-CDC34-1
Target Antigen:
Cell division cycle 34 homolog (S. Cerevisiae)
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/11/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CDC34-1 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CDC34-1 Western blot

Western Blot using CPTC-CDC34-1 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CDC34-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

IHC HPA

Download CPTC-CDC34-1.pdf (103.7 KB)

CPTC-CDC34-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-CDC34-2

Background

Catalog Number:
CPTC-CDC34-2
Target Antigen:
Cell division cycle 34 homolog (S. Cerevisiae)
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/11/2014
Antigen Recognition(s):

External Links

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-CDC34-2 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-CDC34-2 Western blot

Western Blot using CPTC-CDC34-2 as primary Ab against Ag 10253 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-CDC34-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

IHC HPA

Download CPTC-CDC34-2.pdf (114.9 KB)

CPTC-CDC34-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Cell division cycle 34 homolog (S. Cerevisiae)

Background

NCI Identification Number:
10253
Antigen Name:
Cell division cycle 34 homolog (S. Cerevisiae)
CPTC Name:
CPTC-CDC34
Keywords:
CDC34; UBC3; UBE2R1; E2-CDC34; EC 6.3.2.19
Function:
The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins.

This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.

Catalyzes the covalent attachment of ubiquitin to other proteins. May be involved in degradation of katenin.
Chromosomal Localization:
19p13.3
Expression System:
E. Coli
NCBI Accession Number:
BC018143
Swiss Prot Accession Number:
P49427
DNA Source:
HIP : HsCD00002069
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG19
Extinction Coefficient:
41433
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAI
FGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVC
ISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPAN
VDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAE
YCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Native Sequence:
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGP
PNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISI
LHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDA
SVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCV
KTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Calculated Isoelectric Point:
4.41
Molecular Weight:
27009
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

Ag 10253

PAGE of Ag 10253 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com