Skip to Content

BCL2-like 2

Antibody: CPTC-BCL2L2-1

Background

Catalog Number:
CPTC-BCL2L2-1
Target Antigen:
BCL2-like 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-BCL2L2-1 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-BCL2L2-1 Western Blot

Western Blot using CPTC-BCL2L2-1 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-BCL2L2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-BCL2L2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-BCL2L2-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-BCL2L2-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

NAPPA

Download BCL2L2-1.pdf (1.4 MB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Antibody: CPTC-BCL2L2-2

Background

Catalog Number:
CPTC-BCL2L2-2
Target Antigen:
BCL2-like 2
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):
recombinant full-length

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-BCL2L2-2 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-BCL2L2-2 Western Blot

Western Blot using CPTC-BCL2L2-2 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-BCL2L2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-BCL2L2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-BCL2L2-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-BCL2L2-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Antibody: CPTC-BCL2L2-3

Background

Catalog Number:
CPTC-BCL2L2-3
Target Antigen:
BCL2-like 2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/26/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-BCL2L2-3 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-BCL2L2-3 Western Blot

Western Blot using CPTC-BCL2L2-3 as primary Ab against Ag 10179 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-BCL2L2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

CPTC-BCL2L2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-BCL2L2-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-BCL2L2-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

NAPPA

Download BCL2L2-3.pdf (689.6 KB)

Evaluation of antibody by NAPPA

This file shows the reactivity of the antibody with proteins expressed by the NAPPA technique.

Characterization SOP Files

Antigen: BCL2-like 2

Background

NCI Identification Number:
10179
Antigen Name:
BCL2-like 2
CPTC Name:
CPTC-BCL2L2
Keywords:
BCL2L2; BCL-W; BCLW; KIAA0271
Function:
This gene encodes a pro-survival (anti-apoptotic) member of the bcl-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis.

Relative to its Bcl-2 counterparts there is considerably less data on this particular protein however much effort is being made to further understand its cellular roles. Located on chromosome 14q11 it appears to be redundant in most tissues apart from specific examples. It was originally discovered by Gibson et al.

Gibson L, Holmgreen SP, Huang DC, et al. (1996). "bcl-w, a novel member of the bcl-2 family, promotes cell survival.". Oncogene 13 (4): 665
Chromosomal Localization:
14q11.2 - q12
Expression System:
E. Coli
NCBI Accession Number:
NM_004050
Swiss Prot Accession Number:
Q92843
DNA Source:
HIP:HsCD00000436
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
33523
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMATPASAPDTRALVADFVGYKLRQKGYVCGAG
PGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQ
LHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVF
GAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
IHSSGGWAEFTALYGDGALEEARRLREGNWA
Native Sequence:
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAA
DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR
FTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEP
LVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGAL
EEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
Calculated Isoelectric Point:
5.06
Molecular Weight:
18629
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

Ag 10179

PAGE of Ag 10179 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com