Skip to Content

BCL2 like 1

Antibody: CPTC-BCL2L1-1

Background

Catalog Number:
CPTC-BCL2L1-1
Target Antigen:
BCL2 like 1
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-BCL2L1-1 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-BCL2L1-1 Western blot

Western Blot using CPTC-BCL2L1-1 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-BCL2L1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-BCL2L1-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-BCL2L1-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-BCL2L1-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download BCL2L1 pairing.pdf (791.8 KB)

SPR pairing results

These are the results of SPR pairing experiments with BCL2L1 antibodies.

Antibody: CPTC-BCL2L1-2

Background

Catalog Number:
CPTC-BCL2L1-2
Target Antigen:
BCL2 like 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-BCL2L1-2 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-BCL2L1-2 Western blot

Western Blot using CPTC-BCL2L1-2 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-BCL2L1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-BCL2L1-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-BCL2L1-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-BCL2L1-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download BCL2L1 pairing.pdf (791.8 KB)

SPR pairing results

These are the results of SPR pairing experiments with BCL2L1 antibodies.

Antibody: CPTC-BCL2L1-3

Background

Catalog Number:
CPTC-BCL2L1-3
Target Antigen:
BCL2 like 1
Isotype:
IgG2b
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-BCL2L1-3 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-BCL2L1-3 Western blot

Western Blot using CPTC-BCL2L1-3 as primary Ab against BCL2L1 (rAg 10650) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-BCL2L1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

NCI 60 Protein Array

CPTC-BCL2L1-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-BCL2L1-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-BCL2L1-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

SPR

Download BCL2L1 pairing.pdf (791.8 KB)

SPR pairing results

These are the results of SPR pairing experiments with BCL2L1 antibodies.

Antigen: BCL2 like 1

Background

NCI Identification Number:
10650
Antigen Name:
BCL2 like 1
CPTC Name:
CPTC-BCL2L1
Keywords:
BCL2-like 1; BCLX; BCL2L; bcl-xL; Bcl-S; bcl-xS; Apoptosis regulator Bcl-X;BCLXL; BCLXS; BCL-XL/S; bcl2-L-1; bcl-2-like protein 1; Bcl2-L-1
Function:
Potent inhibitor of cell death. Inhibits activation of caspases (By similarity). Appears to regulate cell
death by blocking the voltage-dependent anion channnel (VDAC) by binding to it and preventing the release of the
caspase activator, CYC1, from the mitochondrial membrane

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the
production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.

Bcl-2 family proteins regulate and contribute to programmed cell death or apoptosis. It is a large protein family and all members contain at least one of four BH (bcl-2 homology) domains. Certain members such as Bcl-2, Bcl-xl and Mcl1 are anti-apoptotic, whilst others are pro-apoptotic. The pro-apoptotic group of Bcl-2 proteins can be further sub-divided into the structurally diverse 'BH3' only proteins (e.g. Bid, Noxa, Puma and Bad) and the multidomain proteins that share BH1 to 3 (e.g. Bax and Bak). Most Bcl-2 family members contain a C-terminal transmembrane domain that functions to target these proteins to the outer mitochondrial and other intracellular membranes.
Chromosomal Localization:
20q11.21
Expression System:
E. Coli
NCBI Accession Number:
BC019307.1
Swiss Prot Accession Number:
Q07817
DNA Source:
DNASU - HsCD00004711
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
41940
Buffers:
PBS without Ca++ and Mg++
Expressed Sequence:
SNAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEG
TESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPM
AAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAW
MATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF
Native Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMET
PSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAG
DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIV
AFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW
DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Calculated Isoelectric Point:
4.65
Molecular Weight:
23786
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.
Click to enlarge

CPTC-BCL2L1 PAGE

PAGE of BCL2L2 (rAg 10650) with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com