Skip to Content

APEX Nuclease I

Antibody: CPTC-APEX1-2

Background

Catalog Number:
CPTC-APEX1-2
Target Antigen:
APEX Nuclease I
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/19/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-APEX1-2 as primary Ab against Ag 10750 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-APEX1-2 Western blot

Western Blot using CPTC-APEX1-2 as primary Ab against Ag 10750 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-APEX1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-APEX1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).
Click to enlarge

CPTC-APEX1-2 Protein Array

Protein Array in which CPTC-APEX1-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000
Click to enlarge

CPTC-APEX1-2 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000

IHC HPA

Download CPTC-APEX1-2.pdf (114.8 KB)

CPTC-APEX1-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: APEX Nuclease I

Background

NCI Identification Number:
10750
Antigen Name:
APEX Nuclease I
CPTC Name:
CPTC-APEX1
Keywords:
APE; APE-1; APE1; APEN; APEX, APX; HAP1; EC 4.2.99.18; REF1; REF-1; OTTHUMP00000163988
Function:
Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

Repairs oxidative DNA damages in vitro. May have a role in protection against cell lethality and suppression of mutations. Removes the blocking groups from the 3'-termini of the DNA strand breaks generated by ionizing radiations and bleomycin
Chromosomal Localization:
14q11.2
Expression System:
E. Coli
NCBI Accession Number:
BC004979.1
Swiss Prot Accession Number:
P27695
DNA Source:
xxx
Immunogen:
Recombinant Full Length Protein
Vector Name:
HIP : HsCD00003335
Extinction Coefficient:
56568
Buffers:
PBS
Expressed Sequence:
SNAMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATL
KICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEG
YSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAF
RKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLY
PNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Native Sequence:
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKI
CSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGY
SGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAF
RKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHL
YPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Calculated Isoelectric Point:
8.33
Molecular Weight:
35.55
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer  showing nuclear staining using Antibody CPTC-APEX1-2. Titer: 1:5000
Click to enlarge

CPTC-APEX1 PAGE

PAGE of APEX1 (Ag 10750) with molecular weight standards (lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com