Skip to Content

Annexin A1 (Annexin I)

Antibody: CPTC-ANXA1-1

Background

Catalog Number:
CPTC-ANXA1-1
Target Antigen:
Annexin A1 (Annexin I)
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/28/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ANXA1-1 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ANXA1-1 Western Blot

Western Blot using CPTC-ANXA1-1 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-ANXA1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ANXA1-1 Cell Lysate Western blot

Western Blot using CPTC-ANXA1-1 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-ANXA1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-ANXA1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-ANXA1-1NCI60 Protein Array

Protein Array in which CPTC-ANXA1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-ANXA1-1 for NCI60  Cell Line Array with titer 1:4900
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-ANXA1-1 IHC NCI60

Immuno-histochemistry of CPTC-ANXA1-1 for NCI60 Cell Line Array with titer 1:4900
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-1. Titer: 1:4900
Click to enlarge

CPTC-ANXA1-1 IHC Tissue

Tissue Micro-Array(TMA) core of ovarian cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-1. Titer: 1:4900

SPR

Download ANXA1 pairing.pdf (792.6 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

Immuno-MS

Download ANXA1-1.pdf (198.4 KB)

CPT-ANXA1-1 ImmunoMS

This PDF shows the results of immuno capture of annexin1 antigen by the CPTC ANXA1-1 antibody.

Antibody: CPTC-ANXA1-2

Background

Catalog Number:
CPTC-ANXA1-2
Target Antigen:
Annexin A1 (Annexin I)
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/28/2013
Antigen Recognition(s):
recombinant full-length

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ANXA1-2 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ANXA1-2 Western Blot

Western Blot using CPTC-ANXA1-2 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-ANXA1-2 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ANXA1-2 Cell Lysate Western blot

Western Blot using CPTC-ANXA1-2 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-ANXA1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Download Annexin 1 609B58.1.xls (18.0 KB)

CPTC-ANXA1-2 NCI60 Protein Array

Protein Array in which Annexin 1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-ANXA1-2 for NCI60  Cell Line Array at titer 1:7000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:3000
Click to enlarge

CPTC-ANXA1-2 IHC NCI60

Immuno-histochemistry of CPTC-ANXA1-2 for NCI60 Cell Line Array at titer 1:7000
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Titer: 1:3000

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-2. Titer: 1:3000
Click to enlarge

CPTC-ANXA1-2 IHC Tissue

Tissue Micro-Array(TMA) core of lung cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-2. Titer: 1:3000

SPR

Download ANXA1 pairing.pdf (792.6 KB)

Pairing Studies

This file summarizes the results of pairing studies using SPR.

Antibody: CPTC-ANXA1-3

Background

Catalog Number:
CPTC-ANXA1-3
Target Antigen:
Annexin A1 (Annexin I)
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/28/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-ANXA1-3 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ANXA1-3 Western Blot

Western Blot using CPTC-ANXA1-3 as primary Ab against Ag 10278 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Cell Lysate Western Blot

Click to enlarge image Western Blot using CPTC-ANXA1-3 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).
Click to enlarge

CPTC-ANXA1-3 Cell Lysate Western blot

Western Blot using CPTC-ANXA1-3 as primary Ab against cell lysate from NCI-H522 cells (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-ANXA1-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

NCI 60 Protein Array

Click to enlarge image Protein Array in which CPTC-ANXA1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.
Click to enlarge

CPTC-ANXA1-3 NCI 60 Protein Array

Protein Array in which CPTC-ANXA1-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5.

IHC NCI60

Click to enlarge image Immuno-histochemistry of CPTC-ANXA1-3 for NCI60  Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)
Click to enlarge

CPTC-ANXA1-3 IHC NCI60

Immuno-histochemistry of CPTC-ANXA1-3 for NCI60 Cell Line Array at titer 1:100
0=NEGATIVE
1=WEAK(red)
2=MODERATE(blue)
3=STRONG(green)

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-3. Titer: 1:100
Click to enlarge

CPTC-ANXA1-3 IHC Tissue

Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-3. Titer: 1:100

SPR

Download ANXA1 pairing.pdf (792.6 KB)

Pairing Studies

This file summarizes the results of pairing studies by SPR.

Immuno-MS

Download ANXA1-3.pdf (375.2 KB)

CPTC-ANXA1-3 Immuno MS

This PDF provides the results of Immuno MS using ANXA1-3 antibody and annexin 1 antigen.

Antigen: Annexin A1 (Annexin I)

Background

NCI Identification Number:
10278
Antigen Name:
Annexin A1 (Annexin I)
CPTC Name:
CPTC-ANXA1
Keywords:
ANXA1; ANX1; Annexin-1; Chromobindin-9; LPC1; p35
Function:
Annexin I belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Chromosomal Localization:
9q12 - q21.2
Expression System:
E. Coli
NCBI Accession Number:
BC001275
Swiss Prot Accession Number:
P04083
DNA Source:
HIP:HsCD00002583
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
22015
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMASQNRDPAATSVAAARKGAEPSGGAARGPVGKR
LQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAG
TVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
TQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNID
SPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Native Sequence:
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQ
QELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGT
VYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
TQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNI
DSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Calculated Isoelectric Point:
6.56
Molecular Weight:
38987
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of breast cancer showing cytoplasmic staining using Antibody CPTC-ANXA1-3. Titer: 1:100
Click to enlarge

Ag 10278

PAGE of Ag 10278 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com