Skip to Content

Aldo-keto reductase family 1 member C2

Antibody: CPTC-AKR1C2-1

Background

Catalog Number:
CPTC-AKR1C2-1
Target Antigen:
Aldo-keto reductase family 1 member C2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
04/09/2013
Antigen Recognition(s):

Purchase

External Links

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-AKR1C2-1 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-1 mAb as control (lane 3).
Click to enlarge

CPTC-AKR1C2-1 Western Blot

Western Blot using CPTC-AKR1C2-1 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-1 mAb as control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-AKR1C2-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

Cross Reactivity Data

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

NCI 60 Protein Array

CPTC-AKR1C2-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-AKR1C2-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-AKR1C2-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-AKR1C2-1.pdf (106.4 KB)

CPTC-AKR1C2-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-AKR1C2-2

Background

Catalog Number:
CPTC-AKR1C2-2
Target Antigen:
Aldo-keto reductase family 1 member C2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
02/25/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-AKR1C2-2 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-2 mAb as control (lane 3).
Click to enlarge

CPTC-AKR1C2-2 Western Blot

Western Blot using CPTC-AKR1C2-2 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-2 mAb as control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-AKR1C2-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

Cross Reactivity Data

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

NCI 60 Protein Array

CPTC-AKR1C2-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-AKR1C2-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example

IHC Tissue

CPTC-AKR1C2-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-AKR1C2-2.pdf (93.0 KB)

CPTC-AKR1C2-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-AKR1C2-3

Background

Catalog Number:
CPTC-AKR1C2-3
Target Antigen:
Aldo-keto reductase family 1 member C2
Isotype:
IgG2a
Species:
Mouse
Last Updated:
03/07/2013
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-AKR1C2-3 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-3 mAb as control (lane 3).
Click to enlarge

CPTC-AKR1C2-3 Western Blot

Western Blot using CPTC-AKR1C2-3 as primary Ab against Ag 10198 (lane 2). Also included are molecular wt. standards (lane 1) and the AKR1C2-3 mAb as control (lane 3).

Characterization SOP Files

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-AKR1C2-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Characterization SOP Files

Cross Reactivity Data

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

NCI 60 Protein Array

CPTC-AKR1C2-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

IHC NCI60

CPTC-AKR1C2-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Array

IHC Tissue

CPTC-AKR1C2-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

IHC HPA

Download CPTC-AKR1C2-3.pdf (91.3 KB)

CPTC-AKR1C2-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Aldo-keto reductase family 1 member C2

Background

NCI Identification Number:
10198
Antigen Name:
Aldo-keto reductase family 1 member C2
CPTC Name:
CPTC-AKR1C2
Keywords:
AKR1C2; 3-alpha-HSD3; AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; EC 1.-.-.-,EC 1.3.1.20,EC 1.1.1.213; HAKRD; HBAB; MCDR2; OTTHUMP00000018995; OTTHUMP00000044759
Function:
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.
Chromosomal Localization:
10p15-p14
Expression System:
E. Coli
NCBI Accession Number:
BC007024
Swiss Prot Accession Number:
P52895
DNA Source:
HIP : HsCD00004147
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
37548
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSA
HVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQ
LDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKS
IGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYS
ALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSY
NEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Native Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHV
YNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQL
DYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKS
IGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAY
SALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAK
SYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Calculated Isoelectric Point:
7.12
Molecular Weight:
37008
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Ag 10198 PAGE

PAGE of CPTC-AKR1C2 (Ag 10198),with molecular weight standards in lane 1

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com