Skip to Content

Aldo-keto Reductase Family 1 Member C1

Antibody: CPTC-AKR1C1-1

Background

Catalog Number:
CPTC-AKR1C1-1
Target Antigen:
Aldo-keto Reductase Family 1 Member C1
Isotype:
IgG1
Species:
Mouse
Last Updated:
02/11/2014
Antigen Recognition(s):

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-AKR1C1-1 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-AKR1C1-1 Western blot

Western Blot using CPTC-AKR1C1-1 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-AKR1C1-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Cross Reactivity Data

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

IHC HPA

Download CPTC-AKR1C1-1.pdf (87.5 KB)

CPTC-AKR1C1-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antibody: CPTC-AKR1C1-2

Background

Catalog Number:
CPTC-AKR1C1-2
Target Antigen:
Aldo-keto Reductase Family 1 Member C1
Isotype:
IgG3
Species:
Mouse
Last Updated:
04/02/2014
Antigen Recognition(s):

External Links

Purchase

Characterization Data [Compare Characterization Data]

Western Blot

Click to enlarge image Western Blot using CPTC-AKR1C1-2 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).
Click to enlarge

CPTC-AKR1C1-2 Western blot

Western Blot using CPTC-AKR1C1-2 as primary Ab against rAg 10013 (AKR1C1) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

Indirect ELISA

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click to enlarge

CPTC-AKR1C1-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

Cross Reactivity Data

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Cross Reactivity Data

This table shows cross reactivity within the AKR1 family of antigens.

Characterization SOP Files

IHC HPA

Download CPTC-AKR1C1-2.pdf (118.2 KB)

CPTC-AKR1C1-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Antigen: Aldo-keto Reductase Family 1 Member C1

Background

NCI Identification Number:
10013
Antigen Name:
Aldo-keto Reductase Family 1 Member C1
CPTC Name:
CPTC-AKR1C1
Keywords:
AKR1C1; 2-ALPHA-HSD; 20-ALPHA-HSD; C9; DD1; DD1/DD2; DDH; DDH1; H-37; EC 1.1.1.-,EC 1.1.1.149,EC 1.3.1.20; HAKRC; HBAB; MBAB; MGC8954; OTTHUMP00000018992
Function:
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Converts progesterone to its inactive form, 20-alpha-dihydroxyprogesterone(20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May
play a role in myelin formation.
Chromosomal Localization:
10p15-p14
Expression System:
E. Coli
NCBI Accession Number:
NM_001353
Swiss Prot Accession Number:
Q04828
DNA Source:
INV : 4662654
Immunogen:
Recombinant Full Length Protein
Vector Name:
pMCSG7
Extinction Coefficient:
37610
Buffers:
50mM NH4HC03
Expressed Sequence:
SNAMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSA
HLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQ
LDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKS
IGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYS
ALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSY
NEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Native Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHL
YNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQL
DYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKS
IGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAY
SALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAK
SYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Calculated Isoelectric Point:
8.01
Molecular Weight:
37061
Last Updated:
11/14/2012

Links

Characterization Data

Gel

Click to enlarge image This table shows cross reactivity within the AKR1 family of antigens.
Click to enlarge

Ag 10013

PAGE of Ag 10013 (with molecular weight standards in lane 1)

SOPs

Adobe Reader™ required.

Get Adobe Reader for free at Adobe.com